PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G119693_P01
Common NameLOC100272675, ZEAMMB73_484537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 271aa    MW: 29476.8 Da    PI: 5.3705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G119693_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l+  + ++G g+W+++++  g+ R++k+c++rw +yl
  GRMZM2G119693_P01 15 KGLWSPEEDERLYGHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYL 62
                       678*******************************************97 PP

2Myb_DNA-binding46.96.3e-1568111146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg ++++E++l+v +++ lG++ W+ Ia++++ gRt++++k+ w++
  GRMZM2G119693_P01  68 RGGFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNLWNS 111
                        7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-221065IPR009057Homeodomain-like
PROSITE profilePS5129416.8021062IPR017930Myb domain
SuperFamilySSF466893.07E-2812109IPR009057Homeodomain-like
SMARTSM007172.5E-101464IPR001005SANT/Myb domain
PfamPF002491.1E-131562IPR001005SANT/Myb domain
CDDcd001674.55E-101862No hitNo description
PROSITE profilePS5129423.87263117IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2566117IPR009057Homeodomain-like
SMARTSM007173.2E-1367115IPR001005SANT/Myb domain
PfamPF002494.3E-1368112IPR001005SANT/Myb domain
CDDcd001673.18E-1071110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRLSCGGVQ PKLRKGLWSP EEDERLYGHI IRHGVGCWSS VPKLAGLQRC GKSCRLRWIN  60
YLRPDLKRGG FSQQEEDLIV ALHEILGNRW SQIASHLPGR TDNEIKNLWN SCLKKKLRQR  120
GIDPATHKPI AAEAGSAPLH RDDQSKPQQQ PAAAAVFDPF PVTDFGFDLG AAALYGDDVG  180
GDASSDAGFL ADYSSVLDVS ENLGYGESSS NSSGWNCAEM GNAVLDSEAL HWTSAAAAAA  240
TKPEPCSELE QQRSGGLSSE VFNIEFNLEY F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-28911721128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118LKKKLRQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G119693
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G119693_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0391550.0BT039155.1 Zea mays full-length cDNA clone ZM_BFb0377K22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140604.10.0MYB transcription factor
SwissprotP200271e-103MYB3_HORVU; Myb-related protein Hv33
TrEMBLB4FPW70.0B4FPW7_MAIZE; MYB transcription factor
STRINGGRMZM2G119693_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-74myb domain protein 86